PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 253aa    MW: 29174.1 Da    PI: 4.7015
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039772genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l+ +v ++G ++W++ +r  g+ R++k+c++rw++yl
      Lus10039772 14 KGTWTREEDVRLAAYVSRFGCRNWRRLPRDAGLARCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding54.72.2e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+  +v +++ lG++ W+ Ia +m+ +Rt++++k++w+++l
      Lus10039772  67 RGNFTQEEEATIVALHETLGNK-WSVIATYMP-KRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.962961IPR017930Myb domain
SuperFamilySSF466893.31E-2811108IPR009057Homeodomain-like
SMARTSM007172.1E-91363IPR001005SANT/Myb domain
PfamPF002492.5E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-221568IPR009057Homeodomain-like
CDDcd001674.85E-81661No hitNo description
PROSITE profilePS5129425.03962116IPR017930Myb domain
SMARTSM007172.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2569114IPR009057Homeodomain-like
CDDcd001674.03E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MARTPYVDRN GLNKGTWTRE EDVRLAAYVS RFGCRNWRRL PRDAGLARCG KSCRLRWLNY  60
LRPDIKRGNF TQEEEATIVA LHETLGNKWS VIATYMPKRT DNEIKNFWNT HLKRLQPKQE  120
ALESNVSDDI DRHVLLGSPN FEADIENEFS DVDEISSWIE NYNEDINHTT TEVSVSPVQD  180
HDHDHYSPAH QMSARSSFSS NSETEMATTG VTNSGNDELG DLISDYILSQ PFFCHEEFDQ  240
YDTLWSDMVL PY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261211425126MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8883902e-53HQ888390.1 Linum usitatissimum clone GMU2AYZ01B2WV6 microsatellite sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-54MYB-like 102